TBC1D9B Antibody

Immunocytochemistry/Immunofluorescence: TBC1D9B Antibody [NBP1-81490] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & plasma membrane.

Immunohistochemistry-Paraffin: TBC1D9B Antibody [NBP1-81490] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TBC1D9B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBC1D9B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TBC1D9B Protein (NBP1-81490PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TBC1D9B Antibody

• KIAA0676FLJ41880
• MGC157757
• TBC1 domain family member 9B
• TBC1 domain family, member 9B (with GRAM domain)

Background

TBC1D9B may act as a GTPase-activating protein for Rab family protein(s).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBC1D9B