TBC1D22B Antibody


Immunohistochemistry: TBC1D22B Antibody [NBP1-86753] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TBC1D22B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LVARISDQNASGAPPMTVREKTRLEKFRQLLSSQNTDLDELRKCSWPGVPREVRPITWR
Specificity of human TBC1D22B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TBC1D22B Antibody

  • C6orf197
  • chromosome 6 open reading frame 197
  • dJ744I24.2
  • DKFZp762J0110
  • FLJ20337
  • MGC125626
  • MGC125627
  • RP4-744I24.2
  • TBC1 domain family member 22B
  • TBC1 domain family, member 22B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TBC1D22B Antibody (NBP1-86753) (0)

There are no publications for TBC1D22B Antibody (NBP1-86753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D22B Antibody (NBP1-86753) (0)

There are no reviews for TBC1D22B Antibody (NBP1-86753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TBC1D22B Antibody (NBP1-86753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TBC1D22B Products

Bioinformatics Tool for TBC1D22B Antibody (NBP1-86753)

Discover related pathways, diseases and genes to TBC1D22B Antibody (NBP1-86753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TBC1D22B

There are no specific blogs for TBC1D22B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TBC1D22B Antibody and receive a gift card or discount.


Gene Symbol TBC1D22B
Novus 100% Guarantee