TAFA1/FAM19A1 Antibody

Western Blot: TAFA1/FAM19A1 Antibody [NBP1-80702] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TAFA1/FAM19A1 Antibody [NBP1-80702] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: TAFA1/FAM19A1 Antibody [NBP1-80702] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

Immunohistochemistry-Paraffin: TAFA1/FAM19A1 Antibody [NBP1-80702] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: TAFA1/FAM19A1 Antibody [NBP1-80702] - Staining of human cerebellum shows strong cytoplasmic positivity in astrocytes.

Product Discontinued

TAFA1/FAM19A1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM19A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25420068). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25420068).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TAFA1/FAM19A1 Antibody

• Chemokine-like protein TAFA-1
• FAM19A1
• family with sequence similarity 19 (chemokine (C-C motif)-like), member A1
• TAFA1
• TAFA-1

Background

The FAM19A1 gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secretedproteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related toMIP-1alpha, a member of the C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAFA1/FAM19A1 Antibody (NBP1-80702)(2)

Publications using NBP1-80702

• Gong P, Ding Y, Sun R et al. Mesenchymal stem cells alleviate systemic sclerosis by inhibiting the recruitment of pathogenic macrophages Cell death discovery 2022-11-26 [PMID: 36435837]
• Dmitry Usoskin, Alessandro Furlan, Saiful Islam et al. Unbiased classification of sensory neuron types by large-scale single-cell RNA sequencing. Nature Neuroscience 2014-11-24 [PMID: 25420068] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: FAM19A1
• Entrez:
  • 407738(Human)
• Uniprot:
  • Q7Z5A9(Human)