![Western Blot: Syntaxin Antibody (7D9V8) [NBP3-15934] - Western blot analysis of extracts of various cell lines, using Syntaxin antibody (NBP3-15934) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/Syntaxin-Antibody-7D9V8-Western-Blot-NBP3-15934-img0006.jpg "Western Blot: Syntaxin Antibody (7D9V8) [NBP3-15934] - Western blot analysis of extracts of various cell lines, using Syntaxin antibody (NBP3-15934) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clone | 7D9V8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit Syntaxin Antibody (7D9V8) (NBP3-15934) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin (P61266). MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIE |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | See Simple Western Antibody Database for Simple Western validation: antibody dilution of 1:20 |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Syntaxin Antibody (NBP3-15934)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Syntaxin Antibody (7D9V8) [NBP3-15934] - Western blot analysis of extracts of Rat spinal cord, using Syntaxin antibody (NBP3-15934) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/Syntaxin-Antibody-7D9V8-Western-Blot-NBP3-15934-img0007.jpg "Western Blot: Syntaxin Antibody (7D9V8) [NBP3-15934] - Western blot analysis of extracts of Rat spinal cord, using Syntaxin antibody (NBP3-15934) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
![Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded mouse brain tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-72202512435342.jpg "Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded mouse brain tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunofluorescence analysis of paraffin-embedded mouse brain using Syntaxin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-7220251243536.jpg "Immunocytochemistry/ Immunofluorescence: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunofluorescence analysis of paraffin-embedded mouse brain using Syntaxin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded human brain tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-7220251245337.jpg "Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded human brain tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded mouse testis tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-72202512443332.jpg "Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded mouse testis tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded rat brain tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-72202512443320.jpg "Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded rat brain tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded human colon tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-72202512443368.jpg "Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded human colon tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded human pancreas tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-72202512443390.jpg "Immunohistochemistry: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunohistochemistry analysis of Syntaxin in paraffin-embedded human pancreas tissue using Syntaxin Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunofluorescence analysis of paraffin-embedded rat brain using Syntaxin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15934_rabbit-syntaxin-mab-7d9v8-72202512432094.jpg "Immunocytochemistry/ Immunofluorescence: Syntaxin Antibody (7D9V8) [NBP3-15934] - Immunofluorescence analysis of paraffin-embedded rat brain using Syntaxin Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")