STMND1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STMND1 Antibody [NBP2-57594] - Staining of human cell line HEK 293 shows localization to actin filaments.
Orthogonal Strategies: Immunohistochemistry-Paraffin: STMND1 Antibody [NBP2-57594] - Staining in human fallopian tube and prostate tissues using anti-STMND1 antibody. Corresponding STMND1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: STMND1 Antibody [NBP2-57594] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: STMND1 Antibody [NBP2-57594] - Staining of human prostate shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

STMND1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQA
Specificity
Specificity of human, STMND1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STMND1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STMND1 Recombinant Protein Antigen (NBP2-57594PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for STMND1 Antibody

  • Stathmin Domain Containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for STMND1 Antibody (NBP2-57594) (0)

There are no publications for STMND1 Antibody (NBP2-57594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STMND1 Antibody (NBP2-57594) (0)

There are no reviews for STMND1 Antibody (NBP2-57594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STMND1 Antibody (NBP2-57594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional STMND1 Products

Array NBP2-57594

Bioinformatics Tool for STMND1 Antibody (NBP2-57594)

Discover related pathways, diseases and genes to STMND1 Antibody (NBP2-57594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on STMND1

There are no specific blogs for STMND1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STMND1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STMND1