ST8SIA3 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: ST8SIA3 Antibody [NBP2-56457] - Staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ST8SIA3 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit ST8SIA3 Antibody - BSA Free (NBP2-56457) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST8SIA3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ST8SIA3 Recombinant Protein Antigen (NBP2-56457PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ST8SIA3 Antibody - BSA Free

  • Alpha-2,8-sialyltransferase 8C
  • Alpha-2,8-sialyltransferase III
  • EC 2.4.99.-
  • sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase
  • sialyltransferase 8C (alpha2,3Galbeta1,4GlcNAcalpha 2,8-sialyltransferase)
  • Sialyltransferase 8C
  • Sialytransferase St8Sia III
  • SIAT8-C
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3SIAT8C
  • ST8SiaIII

Background

ST8SIA3 belongs to a family of sialyltransferases that form sialyl-alpha-2,8-sialyl-R linkages at the nonreducing termini of glycoconjugates (Lee et al., 1998 [PubMed 9826427]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ST8SIA3 Antibody (NBP2-56457) (0)

There are no publications for ST8SIA3 Antibody (NBP2-56457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8SIA3 Antibody (NBP2-56457) (0)

There are no reviews for ST8SIA3 Antibody (NBP2-56457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ST8SIA3 Antibody (NBP2-56457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST8SIA3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ST8SIA3