SPRYD3 Antibody

Western Blot: SPRYD3 Antibody [NBP1-83681] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: SPRYD3 Antibody [NBP1-83681] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & actin filaments.

Immunohistochemistry-Paraffin: SPRYD3 Antibody [NBP1-83681] - Staining of human cerebral cortex.

Western Blot: SPRYD3 Antibody [NBP1-83681] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: SPRYD3 Antibody [NBP1-83681] - Staining of human cerebellum, cerebral cortex, kidney and lymph node using Anti-SPRYD3 antibody NBP1-83681 (A) shows similar protein distribution across tissues to independent antibody NBP2-38451 (B).

Immunohistochemistry-Paraffin: SPRYD3 Antibody [NBP1-83681] - Staining of human lymph node.

Immunohistochemistry-Paraffin: SPRYD3 Antibody [NBP1-83681] - Staining of human kidney.

Immunohistochemistry-Paraffin: SPRYD3 Antibody [NBP1-83681] - Staining of human cerebellum.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SPRYD3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LARKDYPKNRHPGWSRGSVAYHADDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVRNVRNVMYLH
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPRYD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  SPRYD3 Protein (NBP1-83681PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPRYD3 Antibody

• FLJ14800
• SPRY domain containing 3
• SPRY domain-containing protein 3

Background

SPRYD3 - hypothetical protein FLJ14800

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for SPRYD3 Antibody (NBP1-83681). (Showing 1 - 1 of 1 FAQ).

1. We bought for a few weeks the SPRYD3 Antibody (NBP1-83681) (100 ul). It works wonderful. We need now to use it at a known concentration. On the datasheet and the website, you indicate that the concentration is indicated on the tube. Unfortunately, when we look at it, nothing is written in front of mg/ml. Please could you let us know the concentration of the lot number : R36067.
   • The concentration is not mentioned on the datasheet as it varies lot to lot. The concentration of Lot# R36067 is 0.1 mg/ml.

Bioinformatics

• Gene Symbol: SPRYD3
• Entrez:
  • 84926(Human)
• Uniprot:
  • Q8NCJ5(Human)