SPRYD3 Antibody

Images

 
Western Blot: SPRYD3 Antibody [NBP1-83681] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SPRYD3 Antibody [NBP1-83681] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & actin filaments.
Immunohistochemistry-Paraffin: SPRYD3 Antibody [NBP1-83681] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: SPRYD3 Antibody [NBP1-83681] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPRYD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LARKDYPKNRHPGWSRGSVAYHADDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVRNVRNVMYLH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPRYD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
SPRYD3 Protein (NBP1-83681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPRYD3 Antibody

  • FLJ14800
  • SPRY domain containing 3
  • SPRY domain-containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPRYD3 Antibody (NBP1-83681) (0)

There are no publications for SPRYD3 Antibody (NBP1-83681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRYD3 Antibody (NBP1-83681) (0)

There are no reviews for SPRYD3 Antibody (NBP1-83681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPRYD3 Antibody (NBP1-83681). (Showing 1 - 1 of 1 FAQ).

  1. We bought for a few weeks the SPRYD3 Antibody (NBP1-83681) (100 ul). It works wonderful. We need now to use it at a known concentration. On the datasheet and the website, you indicate that the concentration is indicated on the tube. Unfortunately, when we look at it, nothing is written in front of mg/ml. Please could you let us know the concentration of the lot number : R36067.
    • The concentration is not mentioned on the datasheet as it varies lot to lot. The concentration of Lot# R36067 is 0.1 mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional SPRYD3 Products

Bioinformatics Tool for SPRYD3 Antibody (NBP1-83681)

Discover related pathways, diseases and genes to SPRYD3 Antibody (NBP1-83681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPRYD3

There are no specific blogs for SPRYD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPRYD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRYD3
Entrez
Uniprot