SPOUT1 Antibody


Western Blot: SPOUT1 Antibody [NBP3-17625] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunohistochemistry-Paraffin: SPOUT1 Antibody [NBP3-17625] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

SPOUT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLS
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SPOUT1 Antibody

  • CENP-32
  • centromere protein 32
  • chromosome 9 open reading frame 114
  • DKFZp566D143
  • HSPC109
  • MGC29492


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPOUT1 Antibody (NBP3-17625) (0)

There are no publications for SPOUT1 Antibody (NBP3-17625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPOUT1 Antibody (NBP3-17625) (0)

There are no reviews for SPOUT1 Antibody (NBP3-17625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPOUT1 Antibody (NBP3-17625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPOUT1 Antibody and receive a gift card or discount.


Gene Symbol C9orf114