SPOCD1 Antibody

Images

 
Western Blot: SPOCD1 Antibody [NBP1-93922] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: SPOCD1 Antibody [NBP1-93922] - Staining of human cell line A-431 shows localization to nucleus, nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPOCD1 Antibody [NBP1-93922] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SPOCD1 Antibody [NBP1-93922] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SPOCD1 Antibody [NBP1-93922] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPOCD1 Antibody [NBP1-93922] - Analysis in human testis and liver tissues using NBP1-93922 antibody. Corresponding SPOCD1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: SPOCD1 Antibody [NBP1-93922] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: SPOCD1 Antibody [NBP1-93922] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SPOCD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SPLLSPGLEVTHSSLLLAVLLPKEGLPDTAGSSPWLGKVQKMVSFNSKVEKRYYQPDDRRPNVPLKGTPPPGGAWQQSQGRGSIAPRGISA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPOCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPOCD1 Protein (NBP1-93922PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPOCD1 Antibody

  • FLJ39908
  • SPOC domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPOCD1 Antibody (NBP1-93922) (0)

There are no publications for SPOCD1 Antibody (NBP1-93922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPOCD1 Antibody (NBP1-93922) (0)

There are no reviews for SPOCD1 Antibody (NBP1-93922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPOCD1 Antibody (NBP1-93922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPOCD1 Products

Bioinformatics Tool for SPOCD1 Antibody (NBP1-93922)

Discover related pathways, diseases and genes to SPOCD1 Antibody (NBP1-93922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPOCD1

There are no specific blogs for SPOCD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPOCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPOCD1