SPINK8 Antibody

Images

 
Immunohistochemistry-Paraffin: SPINK8 Antibody [NBP2-14777] - Staining of human bronchus shows strong dot-like cytoplasmic and membranous positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPINK8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPMASERGQLDKTIVECLKNVNKCWFLSYIKPSEPICGSDQVTYSSDCHL CSKILFEGLNITKLYDGQCE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPINK8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPINK8 Protein (NBP2-14777PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPINK8 Antibody

  • SPINK8 serine peptidase inhibitor, Kazal type 8 (putative)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPINK8 Antibody (NBP2-14777) (0)

There are no publications for SPINK8 Antibody (NBP2-14777).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPINK8 Antibody (NBP2-14777) (0)

There are no reviews for SPINK8 Antibody (NBP2-14777). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPINK8 Antibody (NBP2-14777) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK8 Products

SPINK8 NBP2-14777

Bioinformatics Tool for SPINK8 Antibody (NBP2-14777)

Discover related pathways, diseases and genes to SPINK8 Antibody (NBP2-14777). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPINK8

There are no specific blogs for SPINK8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPINK8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK8