SPIN4 Antibody


Western Blot: SPIN4 Antibody [NBP1-93750] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: SPIN4 Antibody [NBP1-93750] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: SPIN4 Antibody [NBP1-93750] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SPIN4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVG
Specificity of human SPIN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SPIN4 Antibody

  • FLJ44984
  • MGC133224
  • spindlin family, member 4
  • spindlin-4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPIN4 Antibody (NBP1-93750) (0)

There are no publications for SPIN4 Antibody (NBP1-93750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPIN4 Antibody (NBP1-93750) (0)

There are no reviews for SPIN4 Antibody (NBP1-93750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPIN4 Antibody (NBP1-93750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SPIN4 Products

Bioinformatics Tool for SPIN4 Antibody (NBP1-93750)

Discover related pathways, diseases and genes to SPIN4 Antibody (NBP1-93750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPIN4

There are no specific blogs for SPIN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPIN4 Antibody and receive a gift card or discount.


Gene Symbol SPIN4