Recombinant Human Sperm Flagellar 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Sperm Flagellar 2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 324-422 of Human FLJ23577 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARY

Protein/Peptide Type
Partial Recombinant Protein
Gene
SPEF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sperm Flagellar 2 Protein

  • cancer/testis antigen 122
  • CT122
  • FLJ23164
  • FLJ23577
  • FLJ25395
  • KIAA1770
  • KPL2MGC102842
  • Protein KPL2
  • sperm flagellar 2
  • sperm flagellar protein 2

Background

FLJ23577 - KPL2 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-86424
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14707
Species: Hu
Applications: IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00079925-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01) (0)

There are no publications for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01) (0)

There are no reviews for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sperm Flagellar 2 Products

Bioinformatics Tool for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01)

Discover related pathways, diseases and genes to Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01)

Discover more about diseases related to Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01).
 

Pathways for Sperm Flagellar 2 Partial Recombinant Protein (H00079925-Q01)

View related products by pathway.

Blogs on Sperm Flagellar 2

There are no specific blogs for Sperm Flagellar 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sperm Flagellar 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPEF2