SPATA33 Antibody

Images

 
Western Blot: C16orf55 Antibody [NBP2-14382] - Analysis in control (vector only transfected HEK293T lysate) and SPATA33 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: C16orf55 Antibody [NBP2-14382] - Staining in human testis and skeletal muscle tissues using anti-SPATA33 antibody. Corresponding SPATA33 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: C16orf55 Antibody [NBP2-14382] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: C16orf55 Antibody [NBP2-14382] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SPATA33 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: SVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEEKPDVKQKSSRKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C16ORF55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPATA33 Recombinant Protein Antigen (NBP2-14382PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA33 Antibody

  • chromosome 16 open reading frame 55
  • FLJ31606
  • hypothetical protein LOC124045

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPATA33 Antibody (NBP2-14382) (0)

There are no publications for SPATA33 Antibody (NBP2-14382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA33 Antibody (NBP2-14382) (0)

There are no reviews for SPATA33 Antibody (NBP2-14382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA33 Antibody (NBP2-14382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C16ORF55