![Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of U2OS cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-93723_rabbit-polyclonal-sorting-nexin-32-antibody-5220251930297.jpg "Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of U2OS cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 218-285 of human Sorting Nexin 32 (NP_689973.2). HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SNX32 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Sorting Nexin 32 Antibody (NBP2-93723)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SNX32 |
![Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of HeLa cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-93723_rabbit-polyclonal-sorting-nexin-32-antibody-52202519313422.jpg "Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of HeLa cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of PC-12 cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-93723_rabbit-polyclonal-sorting-nexin-32-antibody-52202519294570.jpg "Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of PC-12 cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Western blot analysis of lysates from Mouse brain using Sorting Nexin 32 Rabbit pAb(A8006) at 1:3000 dilution.Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit (RM00020).Exposuretime:180s.](http://images.novusbio.com/fullsize/nbp2-93723_rabbit-polyclonal-sorting-nexin-32-antibody-52202519294578.jpg "Western Blot: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Western blot analysis of lysates from Mouse brain using Sorting Nexin 32 Rabbit pAb(A8006) at 1:3000 dilution.Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit (RM00020).Exposuretime:180s.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")