SMIM5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SMIM5 Antibody [NBP2-55832] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMIM5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAATDFVQEMRAVGERLLLKLQRLPQAEPVEI
Specificity
Specificity of human SMIM5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMIM5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMIM5 Recombinant Protein Antigen (NBP2-55832PEP)

Reactivity Notes

Mouse 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMIM5 Antibody

  • C17orf109
  • Chromosome 17 Open Reading Frame 109
  • PP12104
  • Small Integral Membrane Protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMIM5 Antibody (NBP2-55832) (0)

There are no publications for SMIM5 Antibody (NBP2-55832).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMIM5 Antibody (NBP2-55832) (0)

There are no reviews for SMIM5 Antibody (NBP2-55832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMIM5 Antibody (NBP2-55832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-55832

Bioinformatics Tool for SMIM5 Antibody (NBP2-55832)

Discover related pathways, diseases and genes to SMIM5 Antibody (NBP2-55832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SMIM5

There are no specific blogs for SMIM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMIM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMIM5