SMIM4 Antibody


Immunocytochemistry/ Immunofluorescence: SMIM4 Antibody [NBP2-14616] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: SMIM4 Antibody [NBP2-14616] - Staining of human adrenal gland shows cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC

Order Details

SMIM4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IKVRVGQETFYDVYRRKASERQYQRRLEDE
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMIM4 Recombinant Protein Antigen (NBP2-14616PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SMIM4 Antibody

  • C3orf78 chromosome 3 open reading frame 78
  • C3orf78
  • small integral membrane protein 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMIM4 Antibody (NBP2-14616) (0)

There are no publications for SMIM4 Antibody (NBP2-14616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMIM4 Antibody (NBP2-14616) (0)

There are no reviews for SMIM4 Antibody (NBP2-14616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMIM4 Antibody (NBP2-14616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SMIM4 Antibody and receive a gift card or discount.


Gene Symbol SMIM4