SMIM22 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SMIM22 Antibody [NBP2-57772] - Staining of human cell line RT4 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMIM22 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('VSTEELEATVQEVLGRLKSHQFFQSTWDTV',)
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMIM22
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMIM22 Recombinant Protein Antigen (NBP2-57772PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMIM22 Antibody

  • Small Integral Membrane Protein 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMIM22 Antibody (NBP2-57772) (0)

There are no publications for SMIM22 Antibody (NBP2-57772).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMIM22 Antibody (NBP2-57772) (0)

There are no reviews for SMIM22 Antibody (NBP2-57772). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMIM22 Antibody (NBP2-57772) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMIM22 Products

Array NBP2-57772

Bioinformatics Tool for SMIM22 Antibody (NBP2-57772)

Discover related pathways, diseases and genes to SMIM22 Antibody (NBP2-57772). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SMIM22

There are no specific blogs for SMIM22, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMIM22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMIM22