SMIM21 Antibody

Images

 
Immunohistochemistry-Paraffin: C18orf62 Antibody [NBP1-94149] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry: C18orf62 Antibody [NBP1-94149] - Staining of human testis shows strong cytoplasmic and nuclear positivity in leydig cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: C18orf62 Antibody [NBP1-94149] - Staining in human testis and endometrium tissues using anti-SMIM21 antibody. Corresponding SMIM21 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SMIM21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RNHSRIQGVSEDWKRANSIFRNFLRLKSSRNTAEAE
Specificity
Specificity of human C18orf62 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C18orf62
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-94149.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMIM21 Antibody

  • chromosome 18 open reading frame 62
  • MGC126049
  • putative uncharacterized protein C18orf62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMIM21 Antibody (NBP1-94149)(1)

Reviews for SMIM21 Antibody (NBP1-94149) (0)

There are no reviews for SMIM21 Antibody (NBP1-94149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SMIM21 Antibody (NBP1-94149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMIM21 Products

Array NBP1-94149

Bioinformatics Tool for SMIM21 Antibody (NBP1-94149)

Discover related pathways, diseases and genes to SMIM21 Antibody (NBP1-94149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SMIM21

There are no specific blogs for SMIM21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMIM21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C18orf62