SMIM20 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C4orf52 Antibody [NBP1-90942] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: C4orf52 Antibody [NBP1-90942] - Staining of human duodenum shows strong cytoplasmic positivity in granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMIM20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
Specificity
Specificity of human C4orf52 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C4ORF52
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMIM20 Antibody

  • chromosome 4 open reading frame 52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMIM20 Antibody (NBP1-90942) (0)

There are no publications for SMIM20 Antibody (NBP1-90942).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMIM20 Antibody (NBP1-90942) (0)

There are no reviews for SMIM20 Antibody (NBP1-90942). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMIM20 Antibody (NBP1-90942) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMIM20 Products

Array NBP1-90942

Bioinformatics Tool for SMIM20 Antibody (NBP1-90942)

Discover related pathways, diseases and genes to SMIM20 Antibody (NBP1-90942). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SMIM20

There are no specific blogs for SMIM20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMIM20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C4ORF52