SMIM17 Antibody

Images

 
Immunohistochemistry-Paraffin: SMIM17 Antibody [NBP2-57922] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SMIM17 Antibody [NBP2-57922] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SMIM17 Antibody [NBP2-57922] - Staining in human cerebral cortex and pancreas tissues using anti-SMIM17 antibody. Corresponding SMIM17 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SMIM17 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASS
Specificity
Specificity of human SMIM17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMIM17
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SMIM17 Recombinant Protein Antigen (NBP2-57922PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMIM17 Antibody

  • Small Integral Membrane Protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMIM17 Antibody (NBP2-57922) (0)

There are no publications for SMIM17 Antibody (NBP2-57922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMIM17 Antibody (NBP2-57922) (0)

There are no reviews for SMIM17 Antibody (NBP2-57922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SMIM17 Antibody (NBP2-57922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMIM17 Products

Bioinformatics Tool for SMIM17 Antibody (NBP2-57922)

Discover related pathways, diseases and genes to SMIM17 Antibody (NBP2-57922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SMIM17

There are no specific blogs for SMIM17, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMIM17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMIM17