We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SMIM1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] - Analysis in human testis and rectum tissues using NBP2-38120 antibody. Corresponding SMIM1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human rectum shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SMIM1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMIM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SMIM1 Protein (NBP2-38120PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMIM1 Antibody - BSA Free

  • Small Integral Membrane Protein 1 (Vel Blood Group)
  • Small Integral Membrane Protein 1
  • Vel Blood Group Antigen
  • Vel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMIM1 Antibody (NBP2-38120) (0)

There are no publications for SMIM1 Antibody (NBP2-38120).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMIM1 Antibody (NBP2-38120) (0)

There are no reviews for SMIM1 Antibody (NBP2-38120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SMIM1 Antibody (NBP2-38120). (Showing 1 - 1 of 1 FAQ).

  1. May I know whether this Ab can be used for FACS?
    • Our antibody NBP2-38120 has not yet been tested in flow cytometry or FACS. It has only been validated for use in IHC with paraffin embedded tissues. Should you like to try this antibody in flow/FACS you can use our Innovator's Reward Program. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply purchase the product as normal and submit a review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMIM1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SMIM1
Uniprot