![Western Blot: SLC46A3 Antibody [NBP1-85054] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/SLC46A3-Antibody-Western-Blot-NBP1-85054-img0005.jpg "Western Blot: SLC46A3 Antibody [NBP1-85054] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC46A3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-85054 | Applications | Species |
|---|---|---|
| Harder N Effects of Diet on Copper Metabolism Thesis 2023-01-01 | ||
| Harder NHO, Lee HP, Flood VJ et al. Fatty Acid Uptake in Liver Hepatocytes Induces Relocalization and Sequestration of Intracellular Copper Frontiers in molecular biosciences 2022-04-11 [PMID: 35480878] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC46A3 |
![Immunocytochemistry/Immunofluorescence: SLC46A3 Antibody [NBP1-85054] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC46A3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85054-img0006.jpg "Immunocytochemistry/Immunofluorescence: SLC46A3 Antibody [NBP1-85054] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC46A3-Antibody-Immunohistochemistry-Paraffin-NBP1-85054-img0010.jpg "Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts](http://images.novusbio.com/fullsize/SLC46A3-Antibody-Immunohistochemistry-Paraffin-NBP1-85054-img0007.jpg "Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts")
![Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/SLC46A3-Antibody-Immunohistochemistry-Paraffin-NBP1-85054-img0008.jpg "Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC46A3-Antibody-Immunohistochemistry-Paraffin-NBP1-85054-img0009.jpg "Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-85054] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")