![Immunocytochemistry/Immunofluorescence: SLC38A9 Antibody [NBP1-92403] - Staining of human cell line U-251 MG shows localization to nucleoplasm and vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC38A9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92403-img0017.jpg "Immunocytochemistry/Immunofluorescence: SLC38A9 Antibody [NBP1-92403] - Staining of human cell line U-251 MG shows localization to nucleoplasm and vesicles. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SLC38A9 Antibody - BSA Free (NBP1-92403) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SLC38A9 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC38A9 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-92403 | Applications | Species |
|---|---|---|
| Rebsamen M, Pochini L, Stasyk T et al. SLC38A9 is a component of the lysosomal amino acid-sensing machinery that controls mTORC1. Nature 2015-03-26 [PMID: 25561175] (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC38A9 |
![Immunohistochemistry-Paraffin: SLC38A9 Antibody [NBP1-92403] - Staining of human skeletal muscle shows no positivity as expected.](http://images.novusbio.com/fullsize/SLC38A9-Antibody-Immunohistochemistry-Paraffin-NBP1-92403-img0015.jpg "Immunohistochemistry-Paraffin: SLC38A9 Antibody [NBP1-92403] - Staining of human skeletal muscle shows no positivity as expected.")
![Immunohistochemistry-Paraffin: SLC38A9 Antibody [NBP1-92403] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC38A9-Antibody-Immunohistochemistry-Paraffin-NBP1-92403-img0012.jpg "Immunohistochemistry-Paraffin: SLC38A9 Antibody [NBP1-92403] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC38A9 Antibody [NBP1-92403] - Staining of human placenta shows strong granular cytoplasmic positivity in a subset of trophoblastic cells.](http://images.novusbio.com/fullsize/SLC38A9-Antibody-Immunohistochemistry-Paraffin-NBP1-92403-img0014.jpg "Immunohistochemistry-Paraffin: SLC38A9 Antibody [NBP1-92403] - Staining of human placenta shows strong granular cytoplasmic positivity in a subset of trophoblastic cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")