SLC37A2 Antibody - Azide and BSA Free

Western Blot: SLC37A2 Antibody [NBP2-94345] - Analysis of extracts of various cell lines, using SLC37A2 at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.

Product Discontinued

SLC37A2 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-313 of human SLC37A2 (NP_938018.1). VMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSYT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC37A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC37A2 Antibody - Azide and BSA Free

• FLJ00171
• MGC71430
• pp11662
• solute carrier family 37 (glycerol-3-phosphate transporter), member 2
• Solute carrier family 37 member 2
• SPX2
• sugar phosphate exchanger 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC37A2