SLC25A35 Antibody

Images

 
Western Blot: SLC25A35 Antibody [NBP1-59606] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

SLC25A35 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human SLC25A35. Peptide sequence: DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC25A35 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC25A35 Antibody

  • FLJ40217
  • MGC120446
  • MGC120448
  • solute carrier family 25 member 35
  • solute carrier family 25, member 35

Background

SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59607
Species: Hu
Applications: WB
NBP1-93525
Species: Hu
Applications: IHC, IHC-P
NBP1-93778
Species: Hu
Applications: IHC, IHC-P
NBP2-30521
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59600
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13325
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13322
Species: Hu
Applications: IHC, IHC-P
NBP1-59559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30976
Species: Hu
Applications: IHC, IHC-P
NBP1-80527
Species: Hu
Applications: WB
NBP2-20392
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59606
Species: Hu
Applications: WB

Publications for SLC25A35 Antibody (NBP1-59606) (0)

There are no publications for SLC25A35 Antibody (NBP1-59606).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A35 Antibody (NBP1-59606) (0)

There are no reviews for SLC25A35 Antibody (NBP1-59606). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A35 Antibody (NBP1-59606) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A35 Antibody Products

Related Products by Gene

Bioinformatics Tool for SLC25A35 Antibody (NBP1-59606)

Discover related pathways, diseases and genes to SLC25A35 Antibody (NBP1-59606). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A35 Antibody (NBP1-59606)

Discover more about diseases related to SLC25A35 Antibody (NBP1-59606).
 

Pathways for SLC25A35 Antibody (NBP1-59606)

View related products by pathway.

Blogs on SLC25A35

There are no specific blogs for SLC25A35, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SLC25A35
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59606 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought