![Western Blot: SLC17A4 Antibody (3E4) [H00010050-M03] - Analysis of SLC17A4 expression in K-562 (Cat # L009V1).](http://images.novusbio.com/fullsize/SLC17A4-Antibody-3E4-Western-Blot-H00010050-M03-img0003.jpg "Western Blot: SLC17A4 Antibody (3E4) [H00010050-M03] - Analysis of SLC17A4 expression in K-562 (Cat # L009V1).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3E4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | SLC17A4 (NP_005486.1, 56 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYV |
| Specificity | SLC17A4 - solute carrier family 17 (sodium phosphate), member 4 (3E4) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC17A4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: SLC17A4 Antibody (3E4) [H00010050-M03] - Detection limit for recombinant GST tagged SLC17A4 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SLC17A4-Antibody-3E4-Sandwich-ELISA-H00010050-M03-img0002.jpg "Sandwich ELISA: SLC17A4 Antibody (3E4) [H00010050-M03] - Detection limit for recombinant GST tagged SLC17A4 is 1 ng/ml as a capture antibody.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")