SLC17A4 Antibody (3E4)


Western Blot: SLC17A4 Antibody (3E4) [H00010050-M03] - Analysis of SLC17A4 expression in K-562 (Cat # L009V1).
Sandwich ELISA: SLC17A4 Antibody (3E4) [H00010050-M03] - Detection limit for recombinant GST tagged SLC17A4 is 1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA

Order Details

SLC17A4 Antibody (3E4) Summary

SLC17A4 (NP_005486.1, 56 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYV
SLC17A4 - solute carrier family 17 (sodium phosphate), member 4 (3E4)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC17A4 Antibody (3E4)

  • KAIA2138
  • KIAA2138
  • MGC129623
  • Na/PO4 cotransporter
  • putative small intestine sodium-dependent phosphate transport protein
  • solute carrier family 17 (sodium phosphate), member 4
  • Solute carrier family 17 member 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for SLC17A4 Antibody (H00010050-M03) (0)

There are no publications for SLC17A4 Antibody (H00010050-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A4 Antibody (H00010050-M03) (0)

There are no reviews for SLC17A4 Antibody (H00010050-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC17A4 Antibody (H00010050-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC17A4 Products

Array H00010050-M03

Bioinformatics Tool for SLC17A4 Antibody (H00010050-M03)

Discover related pathways, diseases and genes to SLC17A4 Antibody (H00010050-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC17A4 Antibody (H00010050-M03)

Discover more about diseases related to SLC17A4 Antibody (H00010050-M03).

Pathways for SLC17A4 Antibody (H00010050-M03)

View related products by pathway.

Blogs on SLC17A4

There are no specific blogs for SLC17A4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC17A4 Antibody (3E4) and receive a gift card or discount.


Gene Symbol SLC17A4