SIRP delta Antibody


Immunohistochemistry-Paraffin: SIRP delta Antibody [NBP2-31924] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SIRP delta Antibody [NBP2-31924] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SIRP delta Antibody [NBP2-31924] - Staining in human testis and endometrium tissues using anti-SIRPD antibody. Corresponding SIRPD RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SIRP delta Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: FHVQQTEMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDF
Specificity of human SIRP delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SIRP delta Recombinant Protein Antigen (NBP2-31924PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SIRP delta Antibody

  • dJ576H24.4
  • Protein tyrosine phosphatase non-receptor type substrate 1-like 2
  • protein tyrosine phosphatase, non-receptor type substrate 1-like 2
  • PTPNS1L2
  • signal-regulatory protein delta
  • SIRP delta
  • SIRP-Delta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SIRP delta Antibody (NBP2-31924) (0)

There are no publications for SIRP delta Antibody (NBP2-31924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRP delta Antibody (NBP2-31924) (0)

There are no reviews for SIRP delta Antibody (NBP2-31924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIRP delta Antibody (NBP2-31924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SIRP delta Products

Bioinformatics Tool for SIRP delta Antibody (NBP2-31924)

Discover related pathways, diseases and genes to SIRP delta Antibody (NBP2-31924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for SIRP delta Antibody (NBP2-31924)

Find related products by research area.

Blogs on SIRP delta

There are no specific blogs for SIRP delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SIRP delta Antibody and receive a gift card or discount.


Gene Symbol SIRPD