SIDT2 Antibody

Images

 
Western Blot: SIDT2 Antibody [NBP1-91551] - Host: Rabbit. Target Name: SIDT2. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry: SIDT2 Antibody [NBP1-91551] - R Paraffin Embedded Tissue: Human Placenta cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: SIDT2 Antibody [NBP1-91551] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml SIDT2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SIDT2 is supported by BioGPS gene expression data to be expressed in 721_B

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIDT2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human SIDT2. Peptide sequence LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Canine (93%), Equine (93%), Bovine (100%), Guinea Pig (100%), Rabbit (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIDT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against SIDT2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SIDT2 Antibody

  • DKFZp686L17253
  • FLJ90656
  • SID1 transmembrane family member 2
  • SID1 transmembrane family, member 2
  • UNQ685/PRO1325

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83792
Species: Hu
Applications: IHC, IHC-P
NBP2-27547
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA

Publications for SIDT2 Antibody (NBP1-91551) (0)

There are no publications for SIDT2 Antibody (NBP1-91551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIDT2 Antibody (NBP1-91551) (0)

There are no reviews for SIDT2 Antibody (NBP1-91551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIDT2 Antibody (NBP1-91551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SIDT2 Products

Array NBP1-91551

Bioinformatics Tool for SIDT2 Antibody (NBP1-91551)

Discover related pathways, diseases and genes to SIDT2 Antibody (NBP1-91551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIDT2 Antibody (NBP1-91551)

Discover more about diseases related to SIDT2 Antibody (NBP1-91551).
 

Pathways for SIDT2 Antibody (NBP1-91551)

View related products by pathway.

PTMs for SIDT2 Antibody (NBP1-91551)

Learn more about PTMs related to SIDT2 Antibody (NBP1-91551).

Blogs on SIDT2

There are no specific blogs for SIDT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIDT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIDT2
Uniprot