SHCBP1L Antibody

Images

 
Immunohistochemistry: SHCBP1L Antibody [NBP2-32716] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry: SHCBP1L Antibody [NBP2-32716] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHCBP1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHCBP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHCBP1L Protein (NBP2-32716PEP)
Publications
Read Publication using NBP2-32716.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHCBP1L Antibody

  • C1orf14
  • GE36
  • MGC26911
  • SHC SH2 domain-binding protein 1-like protein
  • SHC SH2-domain binding protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SHCBP1L Antibody (NBP2-32716)(1)

Reviews for SHCBP1L Antibody (NBP2-32716) (0)

There are no reviews for SHCBP1L Antibody (NBP2-32716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SHCBP1L Antibody (NBP2-32716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHCBP1L Products

Bioinformatics Tool for SHCBP1L Antibody (NBP2-32716)

Discover related pathways, diseases and genes to SHCBP1L Antibody (NBP2-32716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SHCBP1L

There are no specific blogs for SHCBP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHCBP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHCBP1L