We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Sentan Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human bronchus shows moderate positivity in cilia of respiratory epithelial cells.
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human fallopian tube shows high expression.
Independent Antibodies: Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-SNTN antibody NBP1-92378 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human testis.
Staining of human prostate shows negative cytoplasmic positivity in glandular cells as expected.
Staining of human fallopian tube shows strong positivity in cilia in glandular cells.
Staining of human liver shows negative cytoplasmic positivity in hepatocytes as expected.
Orthogonal Strategies: Analysis in human fallopian tube and prostate tissues using NBP1-92378 antibody. Corresponding SNTN RNA-seq data are presented for the same tissues.
Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.
Staining of human fallopian tube).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Sentan Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNTN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sentan Protein (NBP1-92378PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Sentan Antibody - BSA Free

  • FLJ44379
  • S100A1L
  • sentan
  • sentan, cilia apical structure protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sentan Antibody (NBP1-92378) (0)

There are no publications for Sentan Antibody (NBP1-92378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sentan Antibody (NBP1-92378) (0)

There are no reviews for Sentan Antibody (NBP1-92378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Sentan Antibody (NBP1-92378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sentan Products

Research Areas for Sentan Antibody (NBP1-92378)

Find related products by research area.

Blogs on Sentan

There are no specific blogs for Sentan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sentan Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SNTN