Sentan Antibody - BSA Free

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human bronchus shows moderate positivity in cilia of respiratory epithelial cells.

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-SNTN antibody NBP1-92378 (A) shows similar protein distribution across tissues to independent antibody NBP2-38853 (B).

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human testis.

Staining of human prostate shows negative cytoplasmic positivity in glandular cells as expected.

Staining of human fallopian tube shows strong positivity in cilia in glandular cells.

Staining of human liver shows negative cytoplasmic positivity in hepatocytes as expected.

Analysis in human fallopian tube and prostate tissues using NBP1-92378 antibody. Corresponding SNTN RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.

Staining of human fallopian tube).

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sentan Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Sentan Antibody - BSA Free (NBP1-92378) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNTN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Sentan Protein (NBP1-92378PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sentan Antibody - BSA Free

• FLJ44379
• S100A1L
• sentan
• sentan, cilia apical structure protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNTN