SELRC1 Antibody - BSA Free

Images

 
Western Blot: SELRC1 Antibody [NBP1-87392] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SELRC1 Antibody [NBP1-87392] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.
Immunohistochemistry-Paraffin: SELRC1 Antibody [NBP1-87392] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Western Blot: SELRC1 Antibody [NBP1-87392] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SELRC1 Antibody [NBP1-87392] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SELRC1 Antibody [NBP1-87392] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SELRC1 Antibody [NBP1-87392] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SELRC1 Antibody [NBP1-87392] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SELRC1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit SELRC1 Antibody - BSA Free (NBP1-87392) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEVLKNRAQQLHKEQQKGVQPLTFG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SELRC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SELRC1 Protein (NBP1-87392PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SELRC1 Antibody - BSA Free

  • chromosome 1 open reading frame 163
  • FLJ12439
  • hcp beta-lactamase-like protein C1orf163

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SELRC1 Antibody (NBP1-87392) (0)

There are no publications for SELRC1 Antibody (NBP1-87392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SELRC1 Antibody (NBP1-87392) (0)

There are no reviews for SELRC1 Antibody (NBP1-87392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SELRC1 Antibody (NBP1-87392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SELRC1 Products

Research Areas for SELRC1 Antibody (NBP1-87392)

Find related products by research area.

Blogs on SELRC1

There are no specific blogs for SELRC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SELRC1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SELRC1