We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human SEC22C GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Endotoxin, AP

Order Details

Recombinant Human SEC22C GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-303 of Human SEC22C

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSDCGV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SEC22C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
60.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SEC22C GST (N-Term) Protein

  • DKFZp761F2321
  • MGC13261
  • MGC5373
  • SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
  • SEC22 vesicle trafficking protein-like 3 (S. cerevisiae)
  • SEC22 vesicle trafficking protein-like 3
  • SEC22 vesicle-trafficking protein homolog C
  • SEC22 vesicle-trafficking protein-like 3
  • SEC22L3
  • secretion deficient 22C
  • vesicle-trafficking protein SEC22c

Background

The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91277
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25125
Species: Hu
Applications: ICC/IF
NBP1-87035
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5687
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-87497
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92710
Species: Hu
Applications: ELISA, WB
H00009117-P01
Species: Hu
Applications: WB, ELISA, Endotoxin, AP

Publications for SEC22C Recombinant Protein (H00009117-P01) (0)

There are no publications for SEC22C Recombinant Protein (H00009117-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC22C Recombinant Protein (H00009117-P01) (0)

There are no reviews for SEC22C Recombinant Protein (H00009117-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC22C Recombinant Protein (H00009117-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC22C Products

Blogs on SEC22C

There are no specific blogs for SEC22C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SEC22C GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC22C