![Immunocytochemistry/Immunofluorescence: SDHAF4 Antibody [NBP1-86324] - Staining of human cell line A-431 shows localization to nucleus & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/C6orf57-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86324-img0005.jpg "Immunocytochemistry/Immunofluorescence: SDHAF4 Antibody [NBP1-86324] - Staining of human cell line A-431 shows localization to nucleus & mitochondria. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SDHAF4 Antibody - BSA Free (NBP1-86324) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SDHAF4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCID |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C6ORF57 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-86324 | Applications | Species |
|---|---|---|
| Sharma P, Maklashina E, Voehler M et al. Disordered-to-ordered transitions in assembly factors allow the Complex II catalytic subunit to switch binding partners Research Square 2022-12-02 (WB) | WB | |
| Sharma P, Maklashina E, Voehler M et Al. Disordered-to-ordered transitions in assembly factors allow the complex II catalytic subunit to switch binding partners Nat Commun 2024-01-11 [PMID: 38212624] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C6ORF57 |
![Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/C6orf57-Antibody-Immunohistochemistry-Paraffin-NBP1-86324-img0011.jpg "Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/C6orf57-Antibody-Immunohistochemistry-Paraffin-NBP1-86324-img0008.jpg "Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/C6orf57-Antibody-Immunohistochemistry-Paraffin-NBP1-86324-img0010.jpg "Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/C6orf57-Antibody-Immunohistochemistry-Paraffin-NBP1-86324-img0009.jpg "Immunohistochemistry-Paraffin: SDHAF4 Antibody [NBP1-86324] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")