We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]

Images

 
CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible ...read more

Product Details

Summary
Reactivity V, VSpecies Glossary
Applications WB, ELISA, ICC/IF, ELISA
Clone
AP201054
Clonality
Monoclonal
Host
Mouse
Conjugate
CoraFluor 1

Order Details

SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1] Summary

Description
CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.

CoraFluor(TM) 1, amine reactive

CoraFluor(TM) 1, thiol reactive

For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
Immunogen
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
N
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Direct ELISA
  • ELISA
  • Immunoassay
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).

Packaging, Storage & Formulations

Storage
Store at 4C in the dark. Do not freeze.
Buffer
PBS
Preservative
No Preservative
Purity
Protein G purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1]

  • N protein
  • N structural protein
  • N
  • NC
  • Nucleocapsid protein
  • Nucleoprotein
  • Protein N
  • SARS coronavirus N protein
  • SARS coronavirus nucleocapsid protein
  • SARS CoV N protein
  • SARS CoV nucleocapsid protein
  • SARS CoV
  • SARS N protein
  • SARS Nucleoprotein
  • SARSCoV N protein
  • SARSCoV nucleocapsid protein
  • SARSCoV
  • Severe acute respiratory syndrome

Background

It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS Nucleocapsid Protein Antibody (NBP2-90967CL1) (0)

There are no publications for SARS Nucleocapsid Protein Antibody (NBP2-90967CL1).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967CL1) (0)

There are no reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967CL1). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SARS Nucleocapsid Protein Antibody (NBP2-90967CL1) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS Nucleocapsid Protein Antibody (AP201054) [CoraFluor™ 1] and receive a gift card or discount.

Bioinformatics

Gene Symbol N