SARS Nucleocapsid Protein Antibody (AP201054)

Images

 
There are currently no images for SARS Nucleocapsid Protein Antibody (NBP2-90967).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity VSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
AP201054
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

View Available Conjugates
Catalog# & Conjugate Size Price

SARS Nucleocapsid Protein Antibody (AP201054) Summary

Immunogen
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
N
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Species cross reactivity based on immunogen sequence homology: COVID-19 (84%)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
No Preservative
Concentration
LYOPH
Purity
Protein G purified
Reconstitution Instructions
Reconstitute the antibody with 200 ul sterile PBS and the final concentration is 500 ug/ml. Aliquot and store frozen at <-20 for at least for six months without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Alternate Names for SARS Nucleocapsid Protein Antibody (AP201054)

  • COVID-19 nucleocapsid protein
  • N protein
  • N structural protein
  • N
  • NC
  • Nucleocapsid protein
  • Nucleoprotein
  • Protein N
  • SARS coronavirus N protein
  • SARS coronavirus nucleocapsid protein
  • SARS CoV N protein
  • SARS CoV nucleocapsid protein
  • SARS CoV
  • SARS N protein
  • SARS Nucleoprotein
  • SARSCoV N protein
  • SARSCoV nucleocapsid protein
  • SARSCoV
  • SARSCOV2 N protein
  • SARS-COV-2 nucleocapsid protein
  • SARS-COV-2 Nucleoprotein
  • Severe acute respiratory syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS Nucleocapsid Protein Antibody (NBP2-90967) (0)

There are no publications for SARS Nucleocapsid Protein Antibody (NBP2-90967).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967) (0)

There are no reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SARS Nucleocapsid Protein Antibody (NBP2-90967) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 647 NBP2-90967AF647

Additional SARS Nucleocapsid Protein Products

Bioinformatics Tool for SARS Nucleocapsid Protein Antibody (NBP2-90967)

Discover related pathways, diseases and genes to SARS Nucleocapsid Protein Antibody (NBP2-90967). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SARS Nucleocapsid Protein

There are no specific blogs for SARS Nucleocapsid Protein, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS Nucleocapsid Protein Antibody (AP201054) and receive a gift card or discount.

Bioinformatics

Gene Symbol N