SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

• Reactivity: V, V
• Applications: WB, ELISA, ICC/IF, ELISA
• Clone: AP201054
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free
• Concentration: LYOPH

SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free Summary

• Immunogen: The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
• Isotype: IgG
• Clonality: Monoclonal
• Host: Mouse
• Gene: N
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Direct ELISA
  • ELISA
  • Immunoassay
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:1000
• Application Notes: Use in Immunoassay reported in scientific literature (PMID:34944502)..

Reactivity Notes

Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized from a 0.2 um filtered solution in PBS.
• Preservative: No Preservative
• Concentration: LYOPH
• Purity: Protein G purified
• Reconstitution Instructions: Reconstitute with sterilized PBS to a final concentration of 0.5 mg/ml.

Alternate Names for SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free

• COVID-19 nucleocapsid protein
• N protein
• N structural protein
• N
• NC
• Nucleocapsid protein
• Nucleoprotein
• Protein N
• SARS coronavirus N protein
• SARS coronavirus nucleocapsid protein
• SARS CoV N protein
• SARS CoV nucleocapsid protein
• SARS CoV
• SARS N protein
• SARS Nucleoprotein
• SARSCoV N protein
• SARSCoV nucleocapsid protein
• SARSCoV
• SARSCOV2 N protein
• SARS-COV-2 nucleocapsid protein
• SARS-COV-2 Nucleoprotein
• Severe acute respiratory syndrome

Background

It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS Nucleocapsid Protein Antibody (NBP2-90967)(3)

Publications using NBP2-90967

• Abd El-Lateef HM, El-Dabea T, Khalaf MM Et al. Development of Metal Complexes for Treatment of Coronaviruses Int J Mol Sci 2022-06-24 [PMID: 35742870] (IA)
  
  Details:
  Citation using the HRP version of this antibody.
• Cirri D, Marzo T, Tolbatov I Et al. In Vitro Anti-SARS-CoV-2 Activity of Selected Metal Compounds and Potential Molecular Basis for Their Actions Based on Computational Study Biomolecules 2021-12-24 [PMID: 34944502] (IA, SARS-CoV-2)
  
  Details:
  Citation using the HRP version of this antibody.
• Vicenti I, Martina MG, Boccuto A et al. System-oriented optimization of multi-target 2,6-diaminopurine derivatives: Easily accessible broad-spectrum antivirals active against flaviviruses, influenza virus and SARS-CoV-2 Eur J Med Chem 2021-07-17 [PMID: 34273661] (ELISA)
  
  Details:
  This citation used the HRP format of this antibody.

Bioinformatics

• Gene Symbol: N