| Reactivity | V, VSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, ELISA |
| Clone | AP201054 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Concentration | LYOPH |
| Description | Novus Biologicals Mouse SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free (NBP2-90967) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-SARS Nucleocapsid Protein Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1) |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | N |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunoassay reported in scientific literature (PMID:34944502).. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | Lyophilized from a 0.2 um filtered solution in PBS. |
| Preservative | No Preservative |
| Concentration | LYOPH |
| Purity | Protein G purified |
| Reconstitution Instructions | Reconstitute with sterilized PBS to a final concentration of 0.5 mg/ml. |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | N |