| Reactivity | V, VSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, ELISA |
| Clone | AP201054 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Biotin |
| Description | This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available. |
| Immunogen | The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1) |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | N |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Recommended applications are based on validated applications from the unconjugated base product NBP2-90967. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols. |
| Storage | Store at 4C in the dark. |
| Buffer | PBS |
| Preservative | 0.05% Sodium Azide |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | N |