SARS-CoV-2 ORF6 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ORF6 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
12 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free
Background
SARS-CoV-2 Open Reading Frame 6 (ORF6) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF6 is 61 amino acids (aa) with a theoretical molecular weight of 7.2 kDa (2, 3). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's ORF7a has 68.9% sequence identity and 93.4% sequence similarity (3).
SARS-CoV-2 ORF6 is an ER/Golgi membrane protein that disrupts the formation of the nuclear import complex by binding karyopherin alpha 2 (KPNA2) and karyopherin beta 1 (KPNB1) (2, 4). More specifically, it was found that this disruption is mediated by ORF6's localization to the nuclear pore complex (NPC) where it binds Nup98-Rae1 to target the nuclear import pathway (5). This disruption further prevents the transport of signal transducer and activator of transcription 1 (STAT1) and ultimately blocks interferon (IFN) production and antiviral responses (2, 4, 5). It has been hypothesized that the pathology of COVID-19 is largely initiated by the SARS-CoV-2 proteins ORF6 and non-structural protein 1 (NSP1) which together inhibit STAT1 activity (4). The repression of STAT1 thereby instead promotes STAT3 activation and the upregulation of plasminogen activator inhibitor-1 (PAI-1), leading to a cascade of events that are key features of COVID-19 (4). These harmful events include thrombosis, production of cytokines and chemokines by macrophages, profibrotic changes, hypoxia, and eventual T-cell lymphopenia (4). These finding suggest that targeting STAT1 and STAT3 might be beneficial therapeutic strategies for treating COVID-19.
References
1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1
2. UniProt (P0DTC6)
3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4
4. Matsuyama, T., Kubli, S. P., Yoshinaga, S. K., Pfeffer, K., & Mak, T. W. (2020). An aberrant STAT pathway is central to COVID-19. Cell death and differentiation, 1-17. Advance online publication. https://doi.org/10.1038/s41418-020-00633-7
5. Miorin, L., Kehrer, T., Sanchez-Aparicio, M. T., Zhang, K., Cohen, P., Patel, R. S., Cupic, A., Makio, T., Mei, M., Moreno, E., Danziger, O., White, K. M., Rathnasinghe, R., Uccellini, M., Gao, S., Aydillo, T., Mena, I., Yin, X., Martin-Sancho, L., Krogan, N. J., ... Garcia-Sastre, A. (2020). SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling. Proceedings of the National Academy of Sciences of the United States of America, 202016650. Advance online publication. https://doi.org/10.1073/pnas.2016650117
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for SARS-CoV-2 ORF6 Antibody (NBP3-16001) (0)
There are no publications for SARS-CoV-2 ORF6 Antibody (NBP3-16001).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SARS-CoV-2 ORF6 Antibody (NBP3-16001) (0)
There are no reviews for SARS-CoV-2 ORF6 Antibody (NBP3-16001).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS-CoV-2 ORF6 Antibody (NBP3-16001) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SARS-CoV-2 ORF6 Products
Blogs on SARS-CoV-2 ORF6