We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

Images

 
Western Blot: SARS-CoV-2 ORF6 Antibody [NBP3-16001] - Western blot analysis of extracts of 293T cells, using SARS-CoV-2 ORF6 antibody (NBP3-16001) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) ...read more

Product Details

Summary
Reactivity VSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SARS-CoV-2 ORF6 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORF6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

  • 2019-nCoV ORF6 Protein
  • 2019-nCoV ORF6
  • Accessory Protein 6
  • COVID-19 Non-structural protein 6
  • COVID-19 ns6
  • COVID-19 ORF6
  • COVID-19 Protein X3
  • Human coronavirus ORF6 Protein
  • Non-structural protein 6
  • NS6
  • ORF6 protein
  • SARS-CoV-2 Accessory Protein 6
  • SARS-CoV-2 Non-structural protein 6
  • SARS-CoV-2 ns6
  • SARSCoV2 ORF6 Protein
  • SARS-CoV-2 ORF6 Protein
  • SARS-CoV-2 Protein X3
  • SARS-CoV-2
  • Severe Acute Respiratory Syndrome Coronavirus 2

Background

SARS-CoV-2 Open Reading Frame 6 (ORF6) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF6 is 61 amino acids (aa) with a theoretical molecular weight of 7.2 kDa (2, 3). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's ORF7a has 68.9% sequence identity and 93.4% sequence similarity (3).

SARS-CoV-2 ORF6 is an ER/Golgi membrane protein that disrupts the formation of the nuclear import complex by binding karyopherin alpha 2 (KPNA2) and karyopherin beta 1 (KPNB1) (2, 4). More specifically, it was found that this disruption is mediated by ORF6's localization to the nuclear pore complex (NPC) where it binds Nup98-Rae1 to target the nuclear import pathway (5). This disruption further prevents the transport of signal transducer and activator of transcription 1 (STAT1) and ultimately blocks interferon (IFN) production and antiviral responses (2, 4, 5). It has been hypothesized that the pathology of COVID-19 is largely initiated by the SARS-CoV-2 proteins ORF6 and non-structural protein 1 (NSP1) which together inhibit STAT1 activity (4). The repression of STAT1 thereby instead promotes STAT3 activation and the upregulation of plasminogen activator inhibitor-1 (PAI-1), leading to a cascade of events that are key features of COVID-19 (4). These harmful events include thrombosis, production of cytokines and chemokines by macrophages, profibrotic changes, hypoxia, and eventual T-cell lymphopenia (4). These finding suggest that targeting STAT1 and STAT3 might be beneficial therapeutic strategies for treating COVID-19.

References

1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1

2. UniProt (P0DTC6)

3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4

4. Matsuyama, T., Kubli, S. P., Yoshinaga, S. K., Pfeffer, K., & Mak, T. W. (2020). An aberrant STAT pathway is central to COVID-19. Cell death and differentiation, 1-17. Advance online publication. https://doi.org/10.1038/s41418-020-00633-7

5. Miorin, L., Kehrer, T., Sanchez-Aparicio, M. T., Zhang, K., Cohen, P., Patel, R. S., Cupic, A., Makio, T., Mei, M., Moreno, E., Danziger, O., White, K. M., Rathnasinghe, R., Uccellini, M., Gao, S., Aydillo, T., Mena, I., Yin, X., Martin-Sancho, L., Krogan, N. J., ... Garcia-Sastre, A. (2020). SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling. Proceedings of the National Academy of Sciences of the United States of America, 202016650. Advance online publication. https://doi.org/10.1073/pnas.2016650117

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS-CoV-2 ORF6 Antibody (NBP3-16001) (0)

There are no publications for SARS-CoV-2 ORF6 Antibody (NBP3-16001).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS-CoV-2 ORF6 Antibody (NBP3-16001) (0)

There are no reviews for SARS-CoV-2 ORF6 Antibody (NBP3-16001). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARS-CoV-2 ORF6 Antibody (NBP3-16001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARS-CoV-2 ORF6 Products

Array NBP3-16001

Blogs on SARS-CoV-2 ORF6

There are no specific blogs for SARS-CoV-2 ORF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS-CoV-2 ORF6 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ORF6