SARS-CoV-2 ORF3a Antibody - Azide and BSA Free Summary
Description |
Novus Biologicals Rabbit SARS-CoV-2 ORF3a Antibody - Azide and BSA Free (NBP3-15985) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus ORF3A (YP_009724391.1). GLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ORF3a |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:2000 - 1:6000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free
Background
SARS-CoV-2 Open Reading Frame 3a (ORF3a) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF3a is 475 amino acids (aa) with a theoretical molecular weight of 31 kDa (1, 2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's ORF3a has 72% sequence identity and 90% sequence similarity (3). Structurally, ORF3a is a homotetramer that is comprised of two non-covalently linked homodimers (2).
The SARS-CoV-2 ORF3a protein encodes for a Ca2+ ion channel that functions in NLRP3 (NOD-, LRR- and pyrin domain-containing protein 3) inflammasome activation (3, 4). The ORF3a ion channel also functions in viral particle release as well as apoptotic and necrotic cell death (5). SARS-CoV-2 ORF3a interacts with the inflammasome component TRAF3 (TNF Receptor Associated Factor 3) which activates ASC (apoptosis-associated speck-like protein contain CARD) ubiquitination and, in-turn, stimulates caspase-1 activation and IL-1beta (interleukin-1-beta) production and maturation (3, 4). IL-1beta activation results in cytokine production and the overproduction of cytokines referred to as a cytokine storm, a hallmark of COVID-19 (4). Additionally, high throughput screening experiments have revealed the SARS-CoV-2 ORF3a binds to the human heme oxygenase (HMOX1) protein (5). HMOX1 has a role in reducing inflammation and tissue damage, both features of SARS-CoV-2 infection (5). The ORF3a-HMOX1 interaction will be worth exploring for its role in innate immune response and as a potential therapeutic target for COVID-19 (5).
Alternative names for SARS-CoV-2 ORF3a includes 2019-nCoV ORF3a protein, COVID-19 ORF3a, Human coronavirus ORF3a protein, ORF3a protein, SARS-CoV-2 accessory protein 3a, SARS-CoV-2 protein 3a, SARS-CoV-2 protein U274, and SARS-CoV-2 protein X1.
References
1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-12. UniProt (P0DTC3)
3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4
4. Oladele, J. O., Ajayi, E. I., Oyeleke, O. M., Oladele, O. T., Olowookere, B. D., Adeniyi, B. M., Oyewole, O. I., & Oladiji, A. T. (2020). A systematic review on COVID-19 pandemic with special emphasis on curative potentials of Nigeria based medicinal plants. Heliyon. https://doi.org/10.1016/j.heliyon.2020.e04897
5. Batra, N., De Souza, C., Batra, J., Raetz, A. G., & Yu, A. M. (2020). The HMOX1 Pathway as a Promising Target for the Treatment and Prevention of SARS-CoV-2 of 2019 (COVID-19). International journal of molecular sciences. https://doi.org/10.3390/ijms21176412
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SARS-CoV-2 ORF3a Antibody (NBP3-15985) (0)
There are no publications for SARS-CoV-2 ORF3a Antibody (NBP3-15985).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SARS-CoV-2 ORF3a Antibody (NBP3-15985) (0)
There are no reviews for SARS-CoV-2 ORF3a Antibody (NBP3-15985).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS-CoV-2 ORF3a Antibody (NBP3-15985) (0)