We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SARS-CoV-2 ORF3a Antibody - Azide and BSA Free

Images

 
Western Blot: SARS-CoV-2 ORF3a Antibody [NBP3-15985] - Western blot analysis of extracts of 293T cells, using SARS-CoV-2 ORF3a antibody (NBP3-15985) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) ...read more

Product Details

Summary
Reactivity VSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SARS-CoV-2 ORF3a Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus ORF3A (YP_009724391.1). GLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORF3a
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Western Blot 1:2000 - 1:6000
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SARS-CoV-2 ORF3a Antibody - Azide and BSA Free

  • 2019-nCoV ORF3a Protein
  • 2019-nCoV ORF3a
  • COVID-19 ORF3a
  • Human coronavirus ORF3a Protein
  • ORF3a protein
  • SARS-CoV-2 Accessory protein 3a
  • SARSCoV2 ORF3a Protein
  • SARS-CoV-2 ORF3a Protein
  • SARS-CoV-2 Protein 3a
  • SARS-CoV-2 Protein U274
  • SARS-CoV-2 Protein X1
  • SARS-CoV-2
  • Severe Acute Respiratory Syndrome Coronavirus 2

Background

SARS-CoV-2 Open Reading Frame 3a (ORF3a) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF3a is 475 amino acids (aa) with a theoretical molecular weight of 31 kDa (1, 2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's ORF3a has 72% sequence identity and 90% sequence similarity (3). Structurally, ORF3a is a homotetramer that is comprised of two non-covalently linked homodimers (2).

The SARS-CoV-2 ORF3a protein encodes for a Ca2+ ion channel that functions in NLRP3 (NOD-, LRR- and pyrin domain-containing protein 3) inflammasome activation (3, 4). The ORF3a ion channel also functions in viral particle release as well as apoptotic and necrotic cell death (5). SARS-CoV-2 ORF3a interacts with the inflammasome component TRAF3 (TNF Receptor Associated Factor 3) which activates ASC (apoptosis-associated speck-like protein contain CARD) ubiquitination and, in-turn, stimulates caspase-1 activation and IL-1beta (interleukin-1-beta) production and maturation (3, 4). IL-1beta activation results in cytokine production and the overproduction of cytokines referred to as a cytokine storm, a hallmark of COVID-19 (4). Additionally, high throughput screening experiments have revealed the SARS-CoV-2 ORF3a binds to the human heme oxygenase (HMOX1) protein (5). HMOX1 has a role in reducing inflammation and tissue damage, both features of SARS-CoV-2 infection (5). The ORF3a-HMOX1 interaction will be worth exploring for its role in innate immune response and as a potential therapeutic target for COVID-19 (5).

Alternative names for SARS-CoV-2 ORF3a includes 2019-nCoV ORF3a protein, COVID-19 ORF3a, Human coronavirus ORF3a protein, ORF3a protein, SARS-CoV-2 accessory protein 3a, SARS-CoV-2 protein 3a, SARS-CoV-2 protein U274, and SARS-CoV-2 protein X1.

References

1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-12. UniProt (P0DTC3)

3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4

4. Oladele, J. O., Ajayi, E. I., Oyeleke, O. M., Oladele, O. T., Olowookere, B. D., Adeniyi, B. M., Oyewole, O. I., & Oladiji, A. T. (2020). A systematic review on COVID-19 pandemic with special emphasis on curative potentials of Nigeria based medicinal plants. Heliyon. https://doi.org/10.1016/j.heliyon.2020.e04897

5. Batra, N., De Souza, C., Batra, J., Raetz, A. G., & Yu, A. M. (2020). The HMOX1 Pathway as a Promising Target for the Treatment and Prevention of SARS-CoV-2 of 2019 (COVID-19). International journal of molecular sciences. https://doi.org/10.3390/ijms21176412

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for SARS-CoV-2 ORF3a Antibody (NBP3-15985) (0)

There are no publications for SARS-CoV-2 ORF3a Antibody (NBP3-15985).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS-CoV-2 ORF3a Antibody (NBP3-15985) (0)

There are no reviews for SARS-CoV-2 ORF3a Antibody (NBP3-15985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARS-CoV-2 ORF3a Antibody (NBP3-15985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARS-CoV-2 ORF3a Products

Array NBP3-15985

Blogs on SARS-CoV-2 ORF3a.

Early T cell response is associated with mild COVID-19 and rapid SARS-CoV-2 clearance
Jamshed Arslan, Pharm D, PhD SARS-CoV-2 induces both humoral and cellular immunity. A vaccine or natural infection invokes SARS-CoV-2-specific humoral components (antibodies from activated B cells) and cellular resp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS-CoV-2 ORF3a Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ORF3a