SARS-CoV-2 nsp9 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of coronavirus NSP9 (YP_009742616.1). NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ORF1ab |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:2000 - 1:6000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SARS-CoV-2 nsp9 Antibody - Azide and BSA Free
Background
SARS-CoV-2 Nonstructural Protein 9 (NSP9) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP9 is 113 amino acids (aa) with a theoretical molecular weight of 12.4 kDa (1-3). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP9 has 97.3% sequence identity and 99.1% sequence similarity (1). Structurally NSP9 has a N-terminal beta-barrel made of seven beta-strands and a C-terminal alpha-helix (3). In SARS-CoV, NSP9 is important for viral proliferation; it is unclear if NSP9 plays the same role in SARS-CoV-2 but given the high degree of sequence similarity it is quite likely (4). SARS-CoV-2 NSP9 also plays a role in formation of nuclear transport machinery and the extracellular matrix (2). Additionally, NSP9 binds mind bomb 1 (MIB1), an E3 ubiquitin ligase that regulates antiviral innate immune signaling (2).
References
1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4
2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9
3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39
4. Khan, M. T., Irfan, M., Ahsan, H., Ahmed, A., Kaushik, A. C., Khan, A. S., Chinnasamy, S., Ali, A., & Wei, D. Q. (2021). Structures of SARS-CoV-2 RNA-Binding Proteins and Therapeutic Targets. Intervirology. Advance online publication. https://doi.org/10.1159/000513686
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SARS-CoV-2 nsp9 Antibody (NBP3-15996) (0)
There are no publications for SARS-CoV-2 nsp9 Antibody (NBP3-15996).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SARS-CoV-2 nsp9 Antibody (NBP3-15996) (0)
There are no reviews for SARS-CoV-2 nsp9 Antibody (NBP3-15996).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS-CoV-2 nsp9 Antibody (NBP3-15996) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SARS-CoV-2 nsp9 Products
Blogs on SARS-CoV-2 nsp9