We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SARS-CoV-2 nsp6 Antibody - Azide and BSA Free

Images

 
Western Blot: SARS-CoV-2 nsp6 Antibody [NBP3-16000] - Analysis of extracts of normal 293T cells and 293T transfected with NSP6 Protein, using SARS-CoV-2 nsp6 antibody (NBP3-16000) at 1:1000 dilution. Secondary antibody: ...read more

Product Details

Summary
Reactivity VSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SARS-CoV-2 nsp6 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 236-290 of coronavirus NSP6 (YP_009725302.1). RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORF1ab
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500 - 1:1000
Theoretical MW
794 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SARS-CoV-2 nsp6 Antibody - Azide and BSA Free

  • Non-structural protein 6

Background

SARS-CoV-2 Nonstructural Protein 6 (NSP6) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP6 is 290 amino acids (aa) with a theoretical molecular weight of 33 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP6 has 88.2% sequence identity and 98.3% sequence similarity (1). Structurally, NSP6 is a transmembrane protein with six transmembrane domains (3). SARS-CoV-2 NSP6 functions in autophagosome formation and double membrane vesicle formation (1,3). A SARS-CoV-2 interactome study revealed that NSP6 has a role in vesicle trafficking. Specifically, it is shown to interact with vacuolar ATPase (2).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS-CoV-2 nsp6 Antibody (NBP3-16000) (0)

There are no publications for SARS-CoV-2 nsp6 Antibody (NBP3-16000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS-CoV-2 nsp6 Antibody (NBP3-16000) (0)

There are no reviews for SARS-CoV-2 nsp6 Antibody (NBP3-16000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARS-CoV-2 nsp6 Antibody (NBP3-16000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARS-CoV-2 nsp6 Products

Array NBP3-16000

Blogs on SARS-CoV-2 nsp6

There are no specific blogs for SARS-CoV-2 nsp6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS-CoV-2 nsp6 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ORF1ab