SARS-CoV-2 nsp6 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 nsp6 Antibody [NBP3-16000] - Analysis of extracts of normal 293T cells and 293T transfected with NSP6 Protein, using SARS-CoV-2 nsp6 antibody (NBP3-16000) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: V
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SARS-CoV-2 nsp6 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 236-290 of coronavirus NSP6 (YP_009725302.1). RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ORF1ab
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 794 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SARS-CoV-2 nsp6 Antibody - Azide and BSA Free

• Non-structural protein 6

Background

SARS-CoV-2 Nonstructural Protein 6 (NSP6) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP6 is 290 amino acids (aa) with a theoretical molecular weight of 33 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP6 has 88.2% sequence identity and 98.3% sequence similarity (1). Structurally, NSP6 is a transmembrane protein with six transmembrane domains (3). SARS-CoV-2 NSP6 functions in autophagosome formation and double membrane vesicle formation (1,3). A SARS-CoV-2 interactome study revealed that NSP6 has a role in vesicle trafficking. Specifically, it is shown to interact with vacuolar ATPase (2).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ORF1ab