SARS-CoV-2 nsp6 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 236-290 of coronavirus NSP6 (YP_009725302.1). RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ORF1ab |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
794 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for SARS-CoV-2 nsp6 Antibody - Azide and BSA Free
Background
SARS-CoV-2 Nonstructural Protein 6 (NSP6) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP6 is 290 amino acids (aa) with a theoretical molecular weight of 33 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP6 has 88.2% sequence identity and 98.3% sequence similarity (1). Structurally, NSP6 is a transmembrane protein with six transmembrane domains (3). SARS-CoV-2 NSP6 functions in autophagosome formation and double membrane vesicle formation (1,3). A SARS-CoV-2 interactome study revealed that NSP6 has a role in vesicle trafficking. Specifically, it is shown to interact with vacuolar ATPase (2).
References
1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4
2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9
3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for SARS-CoV-2 nsp6 Antibody (NBP3-16000) (0)
There are no publications for SARS-CoV-2 nsp6 Antibody (NBP3-16000).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SARS-CoV-2 nsp6 Antibody (NBP3-16000) (0)
There are no reviews for SARS-CoV-2 nsp6 Antibody (NBP3-16000).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS-CoV-2 nsp6 Antibody (NBP3-16000) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SARS-CoV-2 nsp6 Products
Blogs on SARS-CoV-2 nsp6