SARS-CoV-2 nsp4 Antibody - BSA Free

Images

 
Western Blot: SARS-CoV-2 nsp4 Antibody - Azide and BSA Free [SARS-CoV-2 nsp4] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with SARS-CoV-2 nsp4 using SARS-CoV-2 nsp4 Rabbit pAb at ...read more

Product Details

Summary
Reactivity VSpecies Glossary
Applications WB, ELISA, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SARS-CoV-2 nsp4 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit SARS-CoV-2 nsp4 Antibody - BSA Free (NBP3-15991) is a polyclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of coronavirus NSP4 (YP_009725300.1). RRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORF1ab
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunoprecipitation 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
  • Western Blot 1:500 - 1:1000
Theoretical MW
794 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for SARS-CoV-2 nsp4 Antibody - BSA Free

  • Corona_NSP4_C
  • Coronavirus nonstructural protein 4 C-terminus
  • Non-structural protein 4
  • nsp4

Background

SARS-CoV-2 Nonstructural Protein 4 (NSP4) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP4 is 500 amino acids (aa) with a theoretical molecular weight of 56.2 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP4 has 80% sequence identity and 95% sequence similarity (1). Structurally, SARS-CoV-2 NSP4 protein has four transmembrane domains (3). SARS-CoV-2 interactome studies revealed that NSP4 interacts with the TIM (translocase of the inner membrane) complex, indicating an association with the mitochondria (2). Additionally, SARS-CoV-2 NSP4 is shown to interact with NSP3 and this interaction is required for viral replication (1). Specifically, the NSP3-NSP4 interaction is responsible for double membrane vesicle formation (3).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for SARS-CoV-2 nsp4 Antibody (NBP3-15991) (0)

There are no publications for SARS-CoV-2 nsp4 Antibody (NBP3-15991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS-CoV-2 nsp4 Antibody (NBP3-15991) (0)

There are no reviews for SARS-CoV-2 nsp4 Antibody (NBP3-15991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARS-CoV-2 nsp4 Antibody (NBP3-15991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARS-CoV-2 nsp4 Products

Array NBP3-15991

Blogs on SARS-CoV-2 nsp4

There are no specific blogs for SARS-CoV-2 nsp4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS-CoV-2 nsp4 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ORF1ab