SARS-CoV-2 nsp4 Antibody - BSA Free

Western Blot: SARS-CoV-2 nsp4 Antibody - Azide and BSA Free [SARS-CoV-2 nsp4] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with SARS-CoV-2 nsp4 using SARS-CoV-2 nsp4 Rabbit pAb at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 20 ug/10 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

• Reactivity: V
• Applications: WB, ELISA, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SARS-CoV-2 nsp4 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of coronavirus NSP4 (YP_009725300.1). RRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ORF1ab
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunoprecipitation 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 794 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for SARS-CoV-2 nsp4 Antibody - BSA Free

• Corona_NSP4_C
• Coronavirus nonstructural protein 4 C-terminus
• Non-structural protein 4
• nsp4

Background

SARS-CoV-2 Nonstructural Protein 4 (NSP4) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP4 is 500 amino acids (aa) with a theoretical molecular weight of 56.2 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP4 has 80% sequence identity and 95% sequence similarity (1). Structurally, SARS-CoV-2 NSP4 protein has four transmembrane domains (3). SARS-CoV-2 interactome studies revealed that NSP4 interacts with the TIM (translocase of the inner membrane) complex, indicating an association with the mitochondria (2). Additionally, SARS-CoV-2 NSP4 is shown to interact with NSP3 and this interaction is required for viral replication (1). Specifically, the NSP3-NSP4 interaction is responsible for double membrane vesicle formation (3).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

3. Qiu, Y., & Xu, K. (2020). Functional studies of the coronavirus nonstructural proteins. STEMedicine. https://doi.org/10.37175/stemedicine.v1i2.39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ORF1ab