SARS-CoV-2 nsp2 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1). SWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASAN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ORF1ab |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:2000 - 1:6000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free
Background
SARS-CoV-2 Nonstructural Protein 2 (NSP2) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP2 is 638 amino acids (aa) with a theoretical molecular weight of 70.5 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP2 has 68.3% sequence identity and 90% sequence similarity (1). SARS-CoV-2 NSP2 is shown to bind two host proteins, prohibitin 1 (PHB1) and prohibitin 2 (PHB2) (1). The NSP2-PHB protein interaction indicates that SARS-CoV-2 NBP2 might function in disturbing the host-cell environment during viral infection (1). A SARS-CoV-2 interactome study revealed that NSP2 has a role in vesicle trafficking, specifically reconfiguring endoplasmic reticulum and Golgi trafficking during viral infection via the WASH complex (Wiskott Aldrich Syndrome protein and scar homologue complex) (2).
References
1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4
2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SARS-CoV-2 nsp2 Antibody (NBP3-15990) (0)
There are no publications for SARS-CoV-2 nsp2 Antibody (NBP3-15990).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SARS-CoV-2 nsp2 Antibody (NBP3-15990) (0)
There are no reviews for SARS-CoV-2 nsp2 Antibody (NBP3-15990).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS-CoV-2 nsp2 Antibody (NBP3-15990) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SARS-CoV-2 nsp2 Products
Blogs on SARS-CoV-2 nsp2