SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 nsp2 Antibody [NBP3-15990] - Western blot analysis of extracts of normal 293T cells and 293T transfected with NSP2 Protein, using SARS-CoV-2 nsp2 antibody (NBP3-15990) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

• Reactivity: V
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SARS-CoV-2 nsp2 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1). SWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ORF1ab
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:2000 - 1:6000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

• Non-structural protein 2
• NSP2
• p65 homolog

Background

SARS-CoV-2 Nonstructural Protein 2 (NSP2) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP2 is 638 amino acids (aa) with a theoretical molecular weight of 70.5 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP2 has 68.3% sequence identity and 90% sequence similarity (1). SARS-CoV-2 NSP2 is shown to bind two host proteins, prohibitin 1 (PHB1) and prohibitin 2 (PHB2) (1). The NSP2-PHB protein interaction indicates that SARS-CoV-2 NBP2 might function in disturbing the host-cell environment during viral infection (1). A SARS-CoV-2 interactome study revealed that NSP2 has a role in vesicle trafficking, specifically reconfiguring endoplasmic reticulum and Golgi trafficking during viral infection via the WASH complex (Wiskott Aldrich Syndrome protein and scar homologue complex) (2).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ORF1ab