We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

Images

 
Western Blot: SARS-CoV-2 nsp2 Antibody [NBP3-15990] - Western blot analysis of extracts of normal 293T cells and 293T transfected with NSP2 Protein, using SARS-CoV-2 nsp2 antibody (NBP3-15990) at 1:5000 dilution. ...read more

Product Details

Summary
Reactivity VSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SARS-CoV-2 nsp2 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1). SWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASAN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORF1ab
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:2000 - 1:6000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

  • Non-structural protein 2
  • NSP2
  • p65 homolog

Background

SARS-CoV-2 Nonstructural Protein 2 (NSP2) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP2 is 638 amino acids (aa) with a theoretical molecular weight of 70.5 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP2 has 68.3% sequence identity and 90% sequence similarity (1). SARS-CoV-2 NSP2 is shown to bind two host proteins, prohibitin 1 (PHB1) and prohibitin 2 (PHB2) (1). The NSP2-PHB protein interaction indicates that SARS-CoV-2 NBP2 might function in disturbing the host-cell environment during viral infection (1). A SARS-CoV-2 interactome study revealed that NSP2 has a role in vesicle trafficking, specifically reconfiguring endoplasmic reticulum and Golgi trafficking during viral infection via the WASH complex (Wiskott Aldrich Syndrome protein and scar homologue complex) (2).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M., ... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for SARS-CoV-2 nsp2 Antibody (NBP3-15990) (0)

There are no publications for SARS-CoV-2 nsp2 Antibody (NBP3-15990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS-CoV-2 nsp2 Antibody (NBP3-15990) (0)

There are no reviews for SARS-CoV-2 nsp2 Antibody (NBP3-15990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARS-CoV-2 nsp2 Antibody (NBP3-15990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS-CoV-2 nsp2 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ORF1ab