SAMD15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SAMD15 Antibody [NBP1-90727] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & nuclear membrane.
Immunohistochemistry: SAMD15 Antibody [NBP1-90727] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SAMD15 Antibody [NBP1-90727] - Staining of human cerebral cortex shows nuclear positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAMD15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLEQKGHTGIKSDSLTLSEFVKAAGLQDYAPEITAPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAMD15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAMD15 Protein (NBP1-90727PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAMD15 Antibody

  • C14orf174
  • family with sequence similarity 15, member A
  • FLJ35963
  • MGC132494
  • MGC132496
  • SAM domain-containing protein 15
  • SAM domain-containing protein C14orf174
  • sterile alpha motif domain containing 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SAMD15 Antibody (NBP1-90727) (0)

There are no publications for SAMD15 Antibody (NBP1-90727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD15 Antibody (NBP1-90727) (0)

There are no reviews for SAMD15 Antibody (NBP1-90727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SAMD15 Antibody (NBP1-90727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAMD15 Products

Bioinformatics Tool for SAMD15 Antibody (NBP1-90727)

Discover related pathways, diseases and genes to SAMD15 Antibody (NBP1-90727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SAMD15

There are no specific blogs for SAMD15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMD15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMD15