SAMD10 Antibody


Immunocytochemistry/ Immunofluorescence: SAMD10 Antibody [NBP1-88305] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SAMD10 Antibody [NBP1-88305] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SAMD10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPGTS
Specificity of human SAMD10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAMD10 Protein (NBP1-88305PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SAMD10 Antibody

  • C20orf136
  • chromosome 20 open reading frame 136
  • D930033N23Rik
  • dJ591C20
  • dJ591C20.7
  • SAM domain-containing protein 10
  • sterile alpha motif domain containing 10
  • sterile alpha motif domain-containing protein 10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SAMD10 Antibody (NBP1-88305) (0)

There are no publications for SAMD10 Antibody (NBP1-88305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD10 Antibody (NBP1-88305) (0)

There are no reviews for SAMD10 Antibody (NBP1-88305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SAMD10 Antibody (NBP1-88305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SAMD10 Products

Bioinformatics Tool for SAMD10 Antibody (NBP1-88305)

Discover related pathways, diseases and genes to SAMD10 Antibody (NBP1-88305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SAMD10

There are no specific blogs for SAMD10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SAMD10 Antibody and receive a gift card or discount.


Gene Symbol SAMD10