RyDEN Antibody

Western Blot: RyDEN Antibody [NBP1-90417] - Analysis in human cell lines SK-MEL-30 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Immunocytochemistry/Immunofluorescence: RyDEN Antibody [NBP1-90417] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RyDEN Antibody [NBP1-90417] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells and very weak cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: RyDEN Antibody [NBP1-90417] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RyDEN Antibody [NBP1-90417] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: RyDEN Antibody [NBP1-90417] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RyDEN Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C19ORF66
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RyDEN Recombinant Protein Antigen (NBP1-90417PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RyDEN Antibody

• chromosome 19 open reading frame 66
• FLJ11286
• FLJ40743
• hypothetical protein LOC55337

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C19ORF66