RWDD2B Antibody


Western Blot: RWDD2B Antibody [NBP1-88272] - Analysis in control (vector only transfected HEK293T lysate) and RWDD2B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: RWDD2B Antibody [NBP1-88272] - Staining of human skeletal muscle shows strong cytoplasmic positivity in a heterogeneous staining pattern.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RWDD2B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LIRHREDIPFDGTNDETERQRKFSIFEEKVFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RWDD2B Protein (NBP1-88272PEP)
Read Publication using NBP1-88272.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RWDD2B Antibody

  • C21orf6
  • chromosome 21 open reading frame 6
  • GL011
  • RWD domain containing 2B
  • RWD domain-containing protein 2B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RWDD2B Antibody (NBP1-88272)(1)

Reviews for RWDD2B Antibody (NBP1-88272) (0)

There are no reviews for RWDD2B Antibody (NBP1-88272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RWDD2B Antibody (NBP1-88272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RWDD2B Products

Bioinformatics Tool for RWDD2B Antibody (NBP1-88272)

Discover related pathways, diseases and genes to RWDD2B Antibody (NBP1-88272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RWDD2B

There are no specific blogs for RWDD2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RWDD2B Antibody and receive a gift card or discount.


Gene Symbol RWDD2B