RSBN1L Antibody

Images

 
Western Blot: RSBN1L Antibody [NBP1-81903] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: RSBN1L Antibody [NBP1-81903] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & aggresome.
Immunohistochemistry-Paraffin: RSBN1L Antibody [NBP1-81903] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.
Western Blot: RSBN1L Antibody [NBP1-81903] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

RSBN1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KRPKMYSKSIQTICSGLLTDVEDQAAKGILNDNIKDYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNNLKRLDTLEFKQLIHIEHQPNGGASVIHAYSNELSHLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSBN1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
RSBN1L Protein (NBP1-81903PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Alternate Names for RSBN1L Antibody

  • FLJ42526
  • FLJ45813
  • MGC71764
  • round spermatid basic protein 1-like protein
  • round spermatid basic protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RSBN1L Antibody (NBP1-81903) (0)

There are no publications for RSBN1L Antibody (NBP1-81903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSBN1L Antibody (NBP1-81903) (0)

There are no reviews for RSBN1L Antibody (NBP1-81903). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RSBN1L Antibody (NBP1-81903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSBN1L Antibody Products

Bioinformatics Tool for RSBN1L Antibody (NBP1-81903)

Discover related pathways, diseases and genes to RSBN1L Antibody (NBP1-81903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RSBN1L

There are no specific blogs for RSBN1L, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RSBN1L

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81903 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought