RRP7A Antibody

Images

 
Western Blot: RRP7A Antibody [NBP1-85647] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: RRP7A Antibody [NBP1-85647] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: RRP7A Antibody [NBP1-85647] - Staining of human lateral ventricle shows nucleolar positivity in neuronal cells and nuclear positivity in glial cells.
Western Blot: RRP7A Antibody [NBP1-85647] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: RRP7A Antibody [NBP1-85647] - Staining of human cell line A-431 shows positivity in nucleus and cytoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RRP7A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRP7A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RRP7A Protein (NBP1-85647PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RRP7A Antibody

  • BK126B4.3
  • CGI-96
  • CTA-126B4.5
  • Gastric cancer antigen Zg14
  • MGC150422
  • MGC150423
  • ribosomal RNA processing 7 homolog A (S. cerevisiae)
  • ribosomal RNA-processing protein 7 homolog A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RRP7A Antibody (NBP1-85647) (0)

There are no publications for RRP7A Antibody (NBP1-85647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRP7A Antibody (NBP1-85647) (0)

There are no reviews for RRP7A Antibody (NBP1-85647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RRP7A Antibody (NBP1-85647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RRP7A Products

Bioinformatics Tool for RRP7A Antibody (NBP1-85647)

Discover related pathways, diseases and genes to RRP7A Antibody (NBP1-85647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RRP7A

There are no specific blogs for RRP7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRP7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRP7A