RPS6KL1 Antibody - BSA Free

Western Blot: RPS6KL1 Antibody [NBP1-81226] - Analysis in control (vector only transfected HEK293T lysate) and RPS6KL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: RPS6KL1 Antibody [NBP1-81226] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.

Immunohistochemistry: RPS6KL1 Antibody [NBP1-81226] - Staining of human cerebellum shows nucleolar positivity in Purkinje cells.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPS6KL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS6KL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPS6KL1 Protein (NBP1-81226PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPS6KL1 Antibody - BSA Free

• EC 2.7.11.1
• FLJ35734
• MGC11287
• ribosomal protein S6 kinase-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for RPS6KL1 Antibody (NBP1-81226). (Showing 1 - 1 of 1 FAQ).

1. I wish to purchase an antibody from you, RPS6KL1 antibody NBP1-81226. Your antibody would be highly useful to me because it is validated in IF as well as in Western Blots. But, you only seem to be selling sizes in 0.1 ml and I do not anticipate needing quite so much antibody, especially one that has no publications and no reviews. Do you have a sample size available for this product?
   • I am very sorry, but we currently do not have a smaller size available for this product at this time. This is a product that we produce under license from the Human Protein Atlas, and as such, it has been very well characterized. You can see all the testing performed.

Bioinformatics

• Gene Symbol: RPS6KL1