RPS6KL1 Antibody - BSA Free

Images

 
Western Blot: RPS6KL1 Antibody [NBP1-81226] - Analysis in control (vector only transfected HEK293T lysate) and RPS6KL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: RPS6KL1 Antibody [NBP1-81226] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry: RPS6KL1 Antibody [NBP1-81226] - Staining of human cerebellum shows nucleolar positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RPS6KL1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS6KL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPS6KL1 Protein (NBP1-81226PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RPS6KL1 Antibody - BSA Free

  • EC 2.7.11.1
  • FLJ35734
  • MGC11287
  • ribosomal protein S6 kinase-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPS6KL1 Antibody (NBP1-81226) (0)

There are no publications for RPS6KL1 Antibody (NBP1-81226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS6KL1 Antibody (NBP1-81226) (0)

There are no reviews for RPS6KL1 Antibody (NBP1-81226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS6KL1 Antibody (NBP1-81226). (Showing 1 - 1 of 1 FAQ).

  1. I wish to purchase an antibody from you, RPS6KL1 antibody NBP1-81226. Your antibody would be highly useful to me because it is validated in IF as well as in Western Blots. But, you only seem to be selling sizes in 0.1 ml and I do not anticipate needing quite so much antibody, especially one that has no publications and no reviews. Do you have a sample size available for this product?
    • I am very sorry, but we currently do not have a smaller size available for this product at this time. This is a product that we produce under license from the Human Protein Atlas, and as such, it has been very well characterized. You can see all the testing performed.

Secondary Antibodies

 

Isotype Controls

Additional RPS6KL1 Products

Research Areas for RPS6KL1 Antibody (NBP1-81226)

Find related products by research area.

Blogs on RPS6KL1

There are no specific blogs for RPS6KL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS6KL1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KL1